PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011088938.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family NAC
Protein Properties Length: 443aa    MW: 50201.8 Da    PI: 7.7003
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011088938.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.83e-51762011127
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                     + pGfrF+Ptdeel+++yL+kk++g++  + evi+evdi+++ePwdLp +++ ++++ew+fFs+r +ky++g++++rat+sgyWkatgk+++v+s
  XP_011088938.1  76 MFPGFRFSPTDEELIQYYLRKKLQGSDEGV-EVIPEVDICRHEPWDLPaQAIIQSDNEWFFFSPRGRKYPNGSQSKRATESGYWKATGKERSVKS 169
                     579************************888.99***************667777899************************************** PP

             NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyr 127
                      +++++g+k+tLvf++grapkg++t+W+mhey 
  XP_011088938.1 170 -GSNVIGTKRTLVFHTGRAPKGQRTEWIMHEYC 201
                     .99*****************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.37E-5768217IPR003441NAC domain
PROSITE profilePS5100554.59776218IPR003441NAC domain
PfamPF023651.4E-2678201IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0033619Biological Processmembrane protein proteolysis
GO:0048573Biological Processphotoperiodism, flowering
GO:0071472Biological Processcellular response to salt stress
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 443 aa     Download sequence    Send to blast
MVQRLLEQSH FRICSLLCQQ HISQSRNLFG NVRQKGFSFV PIIGDEMDGS ERKLGSFARN  60
NTNISMEISI AEASSMFPGF RFSPTDEELI QYYLRKKLQG SDEGVEVIPE VDICRHEPWD  120
LPAQAIIQSD NEWFFFSPRG RKYPNGSQSK RATESGYWKA TGKERSVKSG SNVIGTKRTL  180
VFHTGRAPKG QRTEWIMHEY CTSEKSQDAM VVCRLRKNSE FHLNDNLKKN SIKKDLPAVN  240
NSMTSLSCGE QSGMVDGVKP VDSCSKDCTS SYNSQSVEQV DTGAESDDKQ PSDFSQDGCS  300
SLKKDYADEE DCYADIMKDD IVKLDEHPGP SVVPVVKPKS ELRNNQATVS LLPFQGTANR  360
RLRLRRHRIE SYQEGRIEIY KFVKQNIPIE GGPDSNTWRR PESLIDNLTT KKIKLPFFLL  420
LLTLILMILF LSFIVGFLAD HNG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A2e-437521719167NAC domain-containing protein 19
3swm_B2e-437521719167NAC domain-containing protein 19
3swm_C2e-437521719167NAC domain-containing protein 19
3swm_D2e-437521719167NAC domain-containing protein 19
3swp_A2e-437521719167NAC domain-containing protein 19
3swp_B2e-437521719167NAC domain-containing protein 19
3swp_C2e-437521719167NAC domain-containing protein 19
3swp_D2e-437521719167NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00280DAPTransfer from AT2G27300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011088938.10.0PREDICTED: NAC domain-containing protein 89-like
SwissprotQ9XIN76e-82NAC40_ARATH; NAC domain-containing protein 40
TrEMBLA0A022QFK11e-145A0A022QFK1_ERYGU; Uncharacterized protein
STRINGSolyc06g074170.2.11e-136(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41542243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G44290.12e-80NAC domain containing protein 60